PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009591286.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 310aa    MW: 35564.3 Da    PI: 8.3532
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009591286.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.73.2e-51261571128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     + pGfrFhPtdeelv +yL++kve++++++ e ik++diyk++PwdLpk+ + ++kewyfF+kr +ky+++ r+nr+t+sg+Wkatg d++++s+
  XP_009591286.1  26 MLPGFRFHPTDEELVGFYLRRKVEKRPVTI-ELIKQIDIYKYDPWDLPKSSNMGDKEWYFFCKRGRKYRNSIRPNRVTSSGFWKATGIDRPIYSS 119
                     579************************999.89***************988999****************************************9 PP

             NAM  96 .....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++e +glkk+Lv+y+g+a kg+ktdW+mhe+rl
  XP_009591286.1 120 vgqgrRHECIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 157
                     887766667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-5523188IPR003441NAC domain
PROSITE profilePS5100554.38126188IPR003441NAC domain
PfamPF023651.0E-2528157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MEVENLSCIV TISSYKEEEA DEEDVMLPGF RFHPTDEELV GFYLRRKVEK RPVTIELIKQ  60
IDIYKYDPWD LPKSSNMGDK EWYFFCKRGR KYRNSIRPNR VTSSGFWKAT GIDRPIYSSV  120
GQGRRHECIG LKKSLVYYRG SAGKGTKTDW MMHEFRLPAE NDKSTKHIEA KSIAQEAEVW  180
TLCRIFKRNG SYRKCLPEWR SVAAAKRHPT DTSSKTCSAD SSDYIISFGA PVMRPHNNIT  240
EIKPFSGHVH DISNNSQLLM GQLSSVRQAP SVSHSSYGHT LAPDMNELLL KHGDWDELTS  300
FLDLAVDPLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-492819422174NAC domain-containing protein 19
3swm_B1e-492819422174NAC domain-containing protein 19
3swm_C1e-492819422174NAC domain-containing protein 19
3swm_D1e-492819422174NAC domain-containing protein 19
3swp_A1e-492819422174NAC domain-containing protein 19
3swp_B1e-492819422174NAC domain-containing protein 19
3swp_C1e-492819422174NAC domain-containing protein 19
3swp_D1e-492819422174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591286.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
RefseqXP_016500749.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK554e-89NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A068UZ641e-139A0A068UZ64_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000903271e-124(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16972469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.12e-90NAC domain containing protein 42